Basic Information | |
---|---|
Taxon OID | 3300000206 Open in IMG/M |
Scaffold ID | M3P_c10034520 Open in IMG/M |
Source Dataset Name | Lotic microbial communities from Mississippi River at two locations in the state of Minnesota, sample from River Site 1, Mississippi Headwaters |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Minnesota |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 758 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → unclassified Nitrososphaeria → Nitrososphaeria archaeon | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic → Lotic Microbial Communities From Mississippi River At Two Locations In The State Of Minnesota |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Solway, Minnesota | |||||||
Coordinates | Lat. (o) | 47.349634 | Long. (o) | -95.182806 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F043361 | Metagenome / Metatranscriptome | 156 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
M3P_100345202 | F043361 | GAG | MEPDLSEELAALVMRLYSTQLKRSADEGGGVELSFISNNRLYHLMVQTEDQPTEFTLSAGSANPFMEAPSGLMQGFVRQMRVRYPSVVFGPGGPHGADFGASTHGQKFPGLPLQAEFLRCKQAIDLCLDGTSVVIRELEGD* |
⦗Top⦘ |