Scaffold SI39nov09_10mDRAFT_c1005057

Overview

Basic Information

• Taxon OID: 3300000199
• Scaffold ID: SI39nov09_10mDRAFT_c1005057
• Source Dataset Name: Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 39 11/10/09 10m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 1301
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location

• Location Name: Saanich Inlet 39, Vancouver Island, BC, Canada
• Coordinates
  • Lat. (^o): 48.35
  • Long. (^o): -123.29
  • Depth (m): 10

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021675	Metagenome / Metatranscriptome	218	Y

Sequences

Protein ID	Family	RBS	Sequence
SI39nov09_10mDRAFT_10050573	F021675	GGA	MPLYTFKDKNKNIEYDKELSYEDLQEYIKQDHIEQVFKMNIFRYADGGGIKDQFTDWCKDSTVKGKDNFNPYGKATKDFEKKD*