| Basic Information | |
|---|---|
| Taxon OID | 3300000197 Open in IMG/M |
| Scaffold ID | BBAY57_c10014452 Open in IMG/M |
| Source Dataset Name | Delisea pulchra's surface microbial communities from Botany Bay, Sydney, Australia - BBAY57_SOAP_k21_Abyss_k53_GAA |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | J. Craig Venter Institute (JCVI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 983 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Coriobacteriales → Coriobacteriaceae → Collinsella → Collinsella aerofaciens | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Algae → Red Algae → Unclassified → Unclassified → Delisea Pulchra's Surface → Delisea Pulchra's Surface Microbial Communities From Botany Bay, Sydney, Australia |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Botany Bay, Sydney, NSW, Australia | |||||||
| Coordinates | Lat. (o) | -33.991017 | Long. (o) | 151.232433 | Alt. (m) | Depth (m) | 7 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F037503 | Metagenome / Metatranscriptome | 168 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| BBAY57_100144521 | F037503 | AGGAG | VGFILIEVELPIGLGGVKSYQILMNSECRKIYSAVRAWVLRSLSERERTQIXNDVQQ* |
| ⦗Top⦘ |