| Basic Information | |
|---|---|
| Taxon OID | 3300000178 Open in IMG/M |
| Scaffold ID | FW301_c1040441 Open in IMG/M |
| Source Dataset Name | Pristine groundwater from Oak Ridge Integrated Field Research Center, Tennessee (resequenced) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 598 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Groundwater Microbial Communities From Oak Ridge Integrated Field Research Center, Tennessee, That Are Pristine And Uranium Contaminated |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Oak Ridge, Tennessee, USA | |||||||
| Coordinates | Lat. (o) | 36.11569 | Long. (o) | -84.248657 | Alt. (m) | Depth (m) | 21 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005385 | Metagenome / Metatranscriptome | 402 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| FW301_10404412 | F005385 | N/A | KKRSKRAQSSKFRIRVRYKYHYYKWIQTPDYGSFKDIYEKYKDKGYSFWCADLPPEFSSQDGTWTGYRLDGDKTHTASTLKRYGRHKAWIDPVYKFEGKPVILVYNAT* |
| ⦗Top⦘ |