Scaffold FW301_c1012155

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold FW301_c1012155

Scaffold FW301_c1012155

Overview

Basic Information
Taxon OID	3300000178 Open in IMG/M
Scaffold ID	FW301_c1012155 Open in IMG/M
Source Dataset Name	Pristine groundwater from Oak Ridge Integrated Field Research Center, Tennessee (resequenced)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1002
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Groundwater Microbial Communities From Oak Ridge Integrated Field Research Center, Tennessee, That Are Pristine And Uranium Contaminated

Source Dataset Sampling Location
Location Name	Oak Ridge, Tennessee, USA
Coordinates	Lat. (^o)	36.11569	Long. (^o)	-84.248657	Alt. (m)		Depth (m)	21
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009172	Metagenome / Metatranscriptome	322	Y

Sequences

Protein ID	Family	RBS	Sequence
FW301_10121552	F009172	GAG	MPNKSKNAPNAQPNRGTKKPYEKPAVSSEPIYETLALACGKLSGQGGACNAAPRRS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.