NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold TB03JUN2009E_c007928

Scaffold TB03JUN2009E_c007928


Overview

Basic Information
Taxon OID3300000176 Open in IMG/M
Scaffold IDTB03JUN2009E_c007928 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2018
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameTrout Bog, Vilas County, Wisconsin, USA
CoordinatesLat. (o)46.0412Long. (o)-89.6864Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008745Metagenome / Metatranscriptome328N
F040465Metagenome / Metatranscriptome161N
F094895Metagenome / Metatranscriptome105N

Sequences

Protein IDFamilyRBSSequence
TB03JUN2009E_0079281F094895N/AITEEELFFARFLVKREPFQDRKRLDDWLRIMEEVVKDIGIVYRSSFRLLESNNFKDESILDLFRTLYIIAMAEVDVVKRERT*
TB03JUN2009E_0079282F008745GGAMSNGYQITEEERDTLVCPRLECMGAQELLDVWLLPLVLEVGGILEEAYRTSHQLFERGQGEERLLGYLQHQLMTAITELQVVQGWIASSCNMSSDKECRVLDGEEDKSEGKVLKEGSEANQSADQQADCGKQKSTSYYQWKLRHE*
TB03JUN2009E_0079283F040465N/AMSDKEVDECAQWPEITEEELSFAENLWNRDSSPDEQRLDDWLRVMEEIVATIXYTYHSSFQLLESNNLKNESLLEALRGMYIFAMAEVNVAKRKTTSS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.