NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold LPfeb10P16500mDRAFT_c1023186

Scaffold LPfeb10P16500mDRAFT_c1023186


Overview

Basic Information
Taxon OID3300000173 Open in IMG/M
Scaffold IDLPfeb10P16500mDRAFT_c1023186 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - February 2010 P16 500m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)550
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Marine Group I → Marine Group I thaumarchaeote(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameP16, Pacific Ocean
CoordinatesLat. (o)49.283333Long. (o)-134.666667Alt. (m)Depth (m)500
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006640Metagenome / Metatranscriptome368Y
F081449Metagenome / Metatranscriptome114Y

Sequences

Protein IDFamilyRBSSequence
LPfeb10P16500mDRAFT_10231861F006640AGGCGGMIGFLIFGLVVLATICLWILIEERKSWKFLVWFIPIFLVIVTSTYVTYTSILGFPKPGTPEQGMYLKHYVDEPDWIYLWVLTKKNVPISY
LPfeb10P16500mDRAFT_10231862F081449N/ARPTGKKLTVKIELHKVDPYKIWWIGEKTFTHRGQEETFVRFTIDQDGKLVGDFTYIEKDFVIPYGNIGAVNQNSVEPTGASSFEPQSDERR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.