NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SI34jun09_200mDRAFT_c1019025

Scaffold SI34jun09_200mDRAFT_c1019025


Overview

Basic Information
Taxon OID3300000172 Open in IMG/M
Scaffold IDSI34jun09_200mDRAFT_c1019025 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 200m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1707
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameSaanich Inlet 34, Vancouver Island, BC, Canada
CoordinatesLat. (o)48.6Long. (o)-123.5Alt. (m)Depth (m)200
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F067831Metagenome125N

Sequences

Protein IDFamilyRBSSequence
SI34jun09_200mDRAFT_10190253F067831N/AMKLNYFSFNNYSSSIVTQSLQAAAPFLTGSNPEYWSGKGDNYGVIAGYDWVPSSGSLKLLELNTNIQTPPETNFLDSAVTWWKANNYDTIVLVTRNEEGTVIPSLNLVGDITASLDIDGFTSSIYVQPSYPTPVPDFDVPNTTFVLRFGFDSASPIDYLASDKREFRNFASSSGIESLMPRKMADLPDGFSNGVGVPDVLIKDPTVDYQTLLMNSFQFYDITDDNKNYLLSQSYCEEFILPDLNYNGAYYSEVRGIMMLTPQENIFLQPRNPITADVNVFQTQLPCYILSADSGSYTTTTITRKGAMSGSQVLMSDNSYTNIENVVTGSFLKIRNISGLPDESDGYANKCGNYLWKTWNTSSLSIPSQSNVEVIDVWPDL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.