NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold LPjun09P162000mDRAFT_c1010544

Scaffold LPjun09P162000mDRAFT_c1010544


Overview

Basic Information
Taxon OID3300000163 Open in IMG/M
Scaffold IDLPjun09P162000mDRAFT_c1010544 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P16 2000m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1686
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Marine Group I → Marine Group I thaumarchaeote(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameP16, Pacific Ocean
CoordinatesLat. (o)49.283333Long. (o)-134.666667Alt. (m)Depth (m)2000
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012921Metagenome / Metatranscriptome276Y
F101353Metagenome / Metatranscriptome102N

Sequences

Protein IDFamilyRBSSequence
LPjun09P162000mDRAFT_10105441F012921AGGMADEFDFGFSAVSTEEFSKTQTVTETQPSAVSSEEFGELKKKLDSISSLIQTLGDREDTSLFDETGEIVAANGEKISRVEDKIDKILAMES
LPjun09P162000mDRAFT_10105443F101353AGGAMITFKQYVKEAQAPFNTRSMIFVNYESPALILSSTMIDRIFGQTKVDAWHVTDLDGLKGLKRIEGKKSSISVLTDIQPGRVKIFTKGVETGGGYCVSLEGSLLVSADFDIYSERLEGGRRAIAIESDDYPNLYKDMIKMQDKMWNKYGEKGKLDAGQDFNKLGNSLTQKQKGQFVKEWIDNCESILTKNKKAQEELRKFGRSDWSTYNESVINQIKIKRIYVINDNKLERFGKSYELAKKEFKDVIEVTSKRMGEIIKK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.