Scaffold LPaug08P261000mDRAFT_c1000129

Overview

Basic Information

• Taxon OID: 3300000157
• Scaffold ID: LPaug08P261000mDRAFT_c1000129
• Source Dataset Name: Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2008 P26 1000m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 10284
• Total Scaffold Genes: 11
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 8 (72.73%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location

• Location Name: Line P, North Pacific Ocean
• Coordinates
  • Lat. (^o): 48.35
  • Long. (^o): -123.3
  • Depth (m): 1000

Associated Families

Family	Category	Number of Sequences	3D Structure?
F101330	Metagenome / Metatranscriptome	102	N

Sequences

Protein ID	Family	RBS	Sequence
LPaug08P261000mDRAFT_100012911	F101330	N/A	MWLQNNYTVSFCGFIGVCIGYFTGHQEICIMIGVGIGILIRIVQRKTK*