| Basic Information | |
|---|---|
| Taxon OID | 3300000156 Open in IMG/M |
| Scaffold ID | NODE_c0707153 Open in IMG/M |
| Source Dataset Name | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Ambry Genetics |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4413 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (42.86%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor → Sugar Cane Bagasse Incubating Bioreactor Microbial Communities From Sao Carlos, Brazil, That Are Aerobic And Semianaerobic |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sao Carlos, Brazil | |||||||
| Coordinates | Lat. (o) | -22.080556 | Long. (o) | -48.997778 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F009484 | Metagenome / Metatranscriptome | 317 | Y |
| F057516 | Metagenome / Metatranscriptome | 136 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| NODE_07071533 | F057516 | N/A | ADVAHVLHGTPDVTSLIEALADRLRMLLRTRLVCVLLRREGPFELTAVSAESPQLATSARARHDRHTLRFAADLAQRAVTAGEPITLSVAADVHSLGNLVSPGMLLAAPFRSSRTQGAILIYPRQNGVFTAEERALVAAVVGFGAVAIANAELYVTSHAQAHELHQLLEISSELGSSS |
| NODE_07071536 | F009484 | AGGAG | MTLGKKLYMNFGFILGMVLLLFIVNWVAVRREHAAKDAASASLRLAETTNSVRFQMMQNRLYLSN |
| ⦗Top⦘ |