| Basic Information | |
|---|---|
| Taxon OID | 3300000156 Open in IMG/M |
| Scaffold ID | NODE_c0670751 Open in IMG/M |
| Source Dataset Name | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Ambry Genetics |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2735 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor → Sugar Cane Bagasse Incubating Bioreactor Microbial Communities From Sao Carlos, Brazil, That Are Aerobic And Semianaerobic |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sao Carlos, Brazil | |||||||
| Coordinates | Lat. (o) | -22.080556 | Long. (o) | -48.997778 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001626 | Metagenome / Metatranscriptome | 661 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| NODE_06707513 | F001626 | N/A | VSVLALTTFALLEERAAAQNYLHCVSKKVVIVDAPKRTTSSSTEESLGFWIDEATKTVTLADGKKLNVGRFDDHWISAVSGDVSYELDRQNGTLSYAGSTMKDGIATTIIGAGRCTVAAAPAR* |
| ⦗Top⦘ |