Basic Information | |
---|---|
Taxon OID | 3300000156 Open in IMG/M |
Scaffold ID | NODE_c0314589 Open in IMG/M |
Source Dataset Name | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Ambry Genetics |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 603 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor → Sugar Cane Bagasse Incubating Bioreactor Microbial Communities From Sao Carlos, Brazil, That Are Aerobic And Semianaerobic |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Sao Carlos, Brazil | |||||||
Coordinates | Lat. (o) | -22.080556 | Long. (o) | -48.997778 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F022706 | Metagenome / Metatranscriptome | 213 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
NODE_03145891 | F022706 | N/A | LLGTSSALAFDTSKLGQWGSLGLDDLTPVIAKSARLQQEISEVLSEGNKKQEDVTCVGMRFPGQWKHLGGLRVSPYACDFGAMWLQILATVRITDRRGQAFETITTKAMNNATNVSETNLTWKWTTECSPQSIPGWCS* |
⦗Top⦘ |