| Basic Information | |
|---|---|
| Taxon OID | 3300000153 Open in IMG/M |
| Scaffold ID | SI39nov09_135mDRAFT_c1011131 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 39 11/10/09 135m |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2110 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (14.29%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Saanich Inlet 39, Vancouver Island, BC, Canada | |||||||
| Coordinates | Lat. (o) | 48.35 | Long. (o) | -123.29 | Alt. (m) | Depth (m) | 135 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001235 | Metagenome / Metatranscriptome | 741 | Y |
| F051547 | Metagenome | 144 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| SI39nov09_135mDRAFT_10111312 | F051547 | AGGAG | VKSMIDPLLIATISVIGGAILNTVRGFLGSDETTYDIKKFFGALIIAVFAGIAVAQTLSLASLGITETILIGLSVGFSVDYAVSXAKKTV* |
| SI39nov09_135mDRAFT_10111317 | F001235 | N/A | RHQSDEFTKVNNYKEGVCLGCMKVDVAAATIADICGDCAGKKGREPLLAKVCDKYYGLCFFCSKYKFNIEQVNGRFCNTCHSRIAKITKEYNEKGGFMKTDPFWISMRKKHGKDWKQIMGGYKKSNRR* |
| ⦗Top⦘ |