Scaffold LPaug09P1610mDRAFT_c1043005

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold LPaug09P1610mDRAFT_c1043005

Scaffold LPaug09P1610mDRAFT_c1043005

Overview

Basic Information
Taxon OID	3300000149 Open in IMG/M
Scaffold ID	LPaug09P1610mDRAFT_c1043005 Open in IMG/M
Source Dataset Name	Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P16 10m
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	530
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location Name	P16, Pacific Ocean
Coordinates	Lat. (^o)	49.283333	Long. (^o)	-134.666667	Alt. (m)		Depth (m)	10
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F085819	Metagenome	111	N

Sequences

Protein ID	Family	RBS	Sequence
LPaug09P1610mDRAFT_10430051	F085819	N/A	MIYLPYLLSILGFLSALYAIARVRTLSNDVKKVGFEDFADVHSDVQALKNQLKKTNNRLSGMDAPKHDAEKEAQELLQRMAMNGTQPLQQQNKRVGG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.