Basic Information | |
---|---|
Taxon OID | 3300000149 Open in IMG/M |
Scaffold ID | LPaug09P1610mDRAFT_c1018285 Open in IMG/M |
Source Dataset Name | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P16 10m |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 881 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | P16, Pacific Ocean | |||||||
Coordinates | Lat. (o) | 49.283333 | Long. (o) | -134.666667 | Alt. (m) | Depth (m) | 10 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F105510 | Metagenome | 100 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
LPaug09P1610mDRAFT_10182851 | F105510 | N/A | YINGDTSIMTDLHKAIRAKHNNVVTINGDAKEDIVALDSSGNTVTINWSSVESWNDPDEYKIKRLAEYPSLQEFAEAYCEKEIGGSSTKWDAYKTAYNKVRTDNPKE* |
⦗Top⦘ |