| Basic Information | |
|---|---|
| Taxon OID | 3300000142 Open in IMG/M |
| Scaffold ID | LPaug09P16500mDRAFT_c1003227 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P16 500m |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3892 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (57.14%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | P16, Pacific Ocean | |||||||
| Coordinates | Lat. (o) | 49.283333 | Long. (o) | -134.666667 | Alt. (m) | Depth (m) | 500 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F007391 | Metagenome / Metatranscriptome | 352 | N |
| F076179 | Metagenome | 118 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| LPaug09P16500mDRAFT_10032271 | F007391 | N/A | IEKILAGTLAISLSGCSMLGGFNALDPKNLIKTAATTAVTYVIAGPLPAAANAATSIAVDSVLPDDKPAIGDIEAGNEEQLRAYMFQNLTQTVLYAVIGFLIFTNVVGPWAAQRRARRKAEALAEEQRRKDKYDAMKAELNARRNKD* |
| LPaug09P16500mDRAFT_10032274 | F076179 | GAG | MWKYIGYAGIILPVLGATYGGLQIASQLENQLNMNTQIAEDAHNRIGSIESSMDMYAETQKFALEAMNDKMGYKFEDINREVIQLNKIVSIIEATTMTLEKNSFNNVTMIQFQGLQELIYQQKDALMTLKTDNMMDTGPMDMTPMFYELQNRIMELERVVNDHHSGNWN* |
| ⦗Top⦘ |