Scaffold LP_F_10_SI03_10DRAFT_c1053328

Overview

Basic Information

• Taxon OID: 3300000137
• Scaffold ID: LP_F_10_SI03_10DRAFT_c1053328
• Source Dataset Name: Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample F_10_SI03_10
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 538
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location

• Location Name: Line P, North Pacific Ocean
• Coordinates
  • Lat. (^o): 48.35
  • Long. (^o): -123.3
  • Depth (m): 10

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033444	Metagenome / Metatranscriptome	177	N

Sequences

Protein ID	Family	RBS	Sequence
LP_F_10_SI03_10DRAFT_10533281	F033444	N/A	LFGNSNTKLKRGLMEVKKLITWIPIVAAVLGTIYTGINTIIKLNNTIEQHTLQLREMSTTVSAIDERFTIEVKNLNRAYTEGREEVFREMTNARTEISSARAKVEALNDTYYKMSNSVEDLKYDLKDFKREVTGDY*