| Basic Information | |
|---|---|
| Taxon OID | 3300000133 Open in IMG/M |
| Scaffold ID | SA_S1_NOR02_45mDRAFT_c1025521 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 1 sample NOR 02_45m |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 683 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Norway: Adventfjord, Svalbard Archipelago | |||||||
| Coordinates | Lat. (o) | 78.237209 | Long. (o) | 15.677776 | Alt. (m) | Depth (m) | 45 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F043410 | Metagenome | 156 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| SA_S1_NOR02_45mDRAFT_10255211 | F043410 | N/A | NLQNTDIGKVETFDLQGMINKALIGIMISKEIITEEEILIILGNINRQQEIYFEQQNSPS |
| ⦗Top⦘ |