Scaffold BS_KBA_SWE12_21mDRAFT_c10140697

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold BS_KBA_SWE12_21mDRAFT_c10140697

Scaffold BS_KBA_SWE12_21mDRAFT_c10140697

Overview

Basic Information
Taxon OID	3300000124 Open in IMG/M
Scaffold ID	BS_KBA_SWE12_21mDRAFT_c10140697 Open in IMG/M
Source Dataset Name	Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21m
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	580
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Wetlands → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations

Source Dataset Sampling Location
Location Name	KBA site, Vaertahamnen, Baltic Sea, Sweden
Coordinates	Lat. (^o)	59.363333	Long. (^o)	18.119167	Alt. (m)		Depth (m)	21
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F105068	Metagenome	100	N

Sequences

Protein ID	Family	RBS	Sequence
BS_KBA_SWE12_21mDRAFT_101406971	F105068	GAGG	MIIYFTLTTDEAVYKFQVNKEENLVRVTKMILKSQCPGEWHRSTLMTVDAGRKLVRQLQTR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.