Scaffold BS_KBA_SWE12_21mDRAFT_c10006746

Overview

Basic Information

• Taxon OID: 3300000124
• Scaffold ID: BS_KBA_SWE12_21mDRAFT_c10006746
• Source Dataset Name: Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 3888
• Total Scaffold Genes: 14
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (7.14%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Wetlands → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations

Source Dataset Sampling Location

• Location Name: KBA site, Vaertahamnen, Baltic Sea, Sweden
• Coordinates
  • Lat. (^o): 59.363333
  • Long. (^o): 18.119167
  • Depth (m): 21

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032099	Metagenome / Metatranscriptome	181	Y

Sequences

Protein ID	Family	RBS	Sequence
BS_KBA_SWE12_21mDRAFT_1000674613	F032099	N/A	MEDKRKNNGGHKTAGRKTKVEEAKVNNIFIQALKELYNKDTEEETKIAFVKNTLMDSQRGQLFIAEHIFGKPKEIIEATHNVNDFNIKDIFKVGNKS*