| Basic Information | |
|---|---|
| Taxon OID | 3300000121 Open in IMG/M |
| Scaffold ID | TDF_OR_ARG04_113mDRAFT_c1004778 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from chronically polluted sediments in Tierra del Fuego - site MC sample ARG 03_11.3m |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1891 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | MC site, Ushuaia Bay, Tierra del Fuego, Argentina | |||||||
| Coordinates | Lat. (o) | -54.810872 | Long. (o) | -68.295525 | Alt. (m) | Depth (m) | 11.3 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F018371 | Metagenome / Metatranscriptome | 235 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| TDF_OR_ARG04_113mDRAFT_10047784 | F018371 | GGAGG | MAINNFIQPNRLTNMQEMEVHVTGPDGANRMFIYSGMAEVELTGGLPHPRWSLEVVCFDVGRSYDVENEEVINIVATSSLAGSRTDGVASFAGWQIFGAAGELDEESGRVRMNIAAGARDTQAFLEQISFQVTVLARVKE* |
| ⦗Top⦘ |