Scaffold SA_S2_NOR13_50mDRAFT_c1001631

Overview

Basic Information

• Taxon OID: 3300000120
• Scaffold ID: SA_S2_NOR13_50mDRAFT_c1001631
• Source Dataset Name: Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 2 sample NOR 13_50m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 4867
• Total Scaffold Genes: 11
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (9.09%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations

Source Dataset Sampling Location

• Location Name: Norway: Adventfjord, Svalbard Archipelago
• Coordinates
  • Lat. (^o): 78.243786
  • Long. (^o): 15.656147
  • Depth (m): 50

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010919	Metagenome / Metatranscriptome	297	Y

Sequences

Protein ID	Family	RBS	Sequence
SA_S2_NOR13_50mDRAFT_10016317	F010919	N/A	LYIALLLTNKTDMKETVKLPLEEFKKLYSIKIRLETYFKYMQDDRGVLKDIAPTFLDDAKEYIKEYNELTNEKSYV*