Scaffold KGI_S1_ANT01_95mDRAFT_c10066227

Overview

Basic Information

• Taxon OID: 3300000119
• Scaffold ID: KGI_S1_ANT01_95mDRAFT_c10066227
• Source Dataset Name: Marine microbial communities from chronically polluted sediments in Antarctica -King George Island site S1 sample ANT 01_9.5m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 1189
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations

Source Dataset Sampling Location

• Location Name: S1 site, Potter Cove, King George Island, Antarctic Peninsula
• Coordinates
  • Lat. (^o): -62.230512
  • Long. (^o): -58.656117
  • Depth (m): 9.5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017299	Metagenome / Metatranscriptome	241	Y

Sequences

Protein ID	Family	RBS	Sequence
KGI_S1_ANT01_95mDRAFT_100662273	F017299	N/A	MIKEPLKITLKYYNKEISTQVDHSDLTLDELHELWLEIVRGMGYAQSTIDEYYE*