NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold KGI_S1_ANT01_95mDRAFT_c10065090

Scaffold KGI_S1_ANT01_95mDRAFT_c10065090


Overview

Basic Information
Taxon OID3300000119 Open in IMG/M
Scaffold IDKGI_S1_ANT01_95mDRAFT_c10065090 Open in IMG/M
Source Dataset NameMarine microbial communities from chronically polluted sediments in Antarctica -King George Island site S1 sample ANT 01_9.5m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1205
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (20.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations

Source Dataset Sampling Location
Location NameS1 site, Potter Cove, King George Island, Antarctic Peninsula
CoordinatesLat. (o)-62.230512Long. (o)-58.656117Alt. (m)Depth (m)9.5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008695Metagenome / Metatranscriptome329Y

Sequences

Protein IDFamilyRBSSequence
KGI_S1_ANT01_95mDRAFT_100650902F008695N/AMNYDIKEVKHIWCEEDDRWVYLEYNDTHKIIGMNFMQGDEYESFKKDWCKSDEGLTEFYNSMLYTFPIEKVSVLRLDFINKCMWTFHTAITQREEYPQ*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.