NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold TDF_OR_ARG05_123mDRAFT_c1005266

Scaffold TDF_OR_ARG05_123mDRAFT_c1005266


Overview

Basic Information
Taxon OID3300000118 Open in IMG/M
Scaffold IDTDF_OR_ARG05_123mDRAFT_c1005266 Open in IMG/M
Source Dataset NameMarine microbial communities from chronically polluted sediments in Tierra del Fuego - site OR sample ARG 06_12.3m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1210
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations

Source Dataset Sampling Location
Location NameOR site, Ushuaia Bay, Tierra del Fuego, Argentina
CoordinatesLat. (o)-54.80407Long. (o)-68.288208Alt. (m)Depth (m)12.3
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000352Metagenome / Metatranscriptome1247Y

Sequences

Protein IDFamilyRBSSequence
TDF_OR_ARG05_123mDRAFT_10052665F000352N/AMRTIKLTETDCIFVHYALRMYANQTEGLDNNDKQEIREVAAKFK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.