| Basic Information | |
|---|---|
| Taxon OID | 3300000117 Open in IMG/M |
| Scaffold ID | DelMOWin2010_c10180119 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 667 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine → Marine Microbial Communities From Delaware Coast |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Microbial Observatory off the coast of Delaware, USA | |||||||
| Coordinates | Lat. (o) | 38.84917 | Long. (o) | -75.1076 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F028043 | Metagenome / Metatranscriptome | 193 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| DelMOWin2010_101801192 | F028043 | N/A | MLVVFTWANACEEEVKADLPVCEEYQVSTEEKPCKKGEGNINTVIKALEKLGESGTLPR* |
| ⦗Top⦘ |