Scaffold DelMOWin2010_c10011122

Overview

Basic Information

• Taxon OID: 3300000117
• Scaffold ID: DelMOWin2010_c10011122
• Source Dataset Name: Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 5070
• Total Scaffold Genes: 11
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (54.55%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine → Marine Microbial Communities From Delaware Coast

Source Dataset Sampling Location

• Location Name: Microbial Observatory off the coast of Delaware, USA
• Coordinates
  • Lat. (^o): 38.84917
  • Long. (^o): -75.1076
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034599	Metagenome / Metatranscriptome	174	Y

Sequences

Protein ID	Family	RBS	Sequence
DelMOWin2010_100111222	F034599	AGGAG	MQKSFSNMAPTAQRITKIVVQPFEQHKYKDFPIIVLPENDCGITLTRKFIWAHGKNKRYMVMDDDILMKTRLFGEEKSKRTMTEEDWCYMLDTVSKWMDEGIAWGGCRSCLPPAGKEYIENSGTAEVFFFDGNQLPSADELDWSLSTAEDISLSLQLLSKGYRNRIFDRFVYQSDFVGTEGGCLTMGRNMDMINNNHAKLIEKFPEYVSWNGEKEIRGETMKKIKVMYKKAYLDSQKSKANLLDFMQ*