Scaffold DelMOSpr2010_c10069873

Overview

Basic Information

• Taxon OID: 3300000116
• Scaffold ID: DelMOSpr2010_c10069873
• Source Dataset Name: Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 1433
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine → Marine Microbial Communities From Delaware Coast

Source Dataset Sampling Location

• Location Name: Microbial Observatory off the coast of Delaware, USA
• Coordinates
  • Lat. (^o): 38.848917
  • Long. (^o): -75.1076
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F064618	Metagenome	128	N

Sequences

Protein ID	Family	RBS	Sequence
DelMOSpr2010_100698734	F064618	GGAG	MITTRILAALFVVLFTLTACTGLGLATKGATLIADATGNAQIEQATEILTEVAGDAVPLAGIINITNTNWIMLGLLILGWMLPSPGEILRTIFNPIGWLIKTLLTRR*