Scaffold DelMOSpr2010_c10065619

Overview

Basic Information

• Taxon OID: 3300000116
• Scaffold ID: DelMOSpr2010_c10065619
• Source Dataset Name: Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 1501
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine → Marine Microbial Communities From Delaware Coast

Source Dataset Sampling Location

• Location Name: Microbial Observatory off the coast of Delaware, USA
• Coordinates
  • Lat. (^o): 38.848917
  • Long. (^o): -75.1076
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F016897	Metagenome	244	Y

Sequences

Protein ID	Family	RBS	Sequence
DelMOSpr2010_100656192	F016897	N/A	MQLKYKQKNLRELTKILFNTLKEQNGLAIRMIVRDYNNKQMENKNVKQIRKTSTVS*