Scaffold DelMOSum2011_c10157185

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold DelMOSum2011_c10157185

Scaffold DelMOSum2011_c10157185

Overview

Basic Information
Taxon OID	3300000115 Open in IMG/M
Scaffold ID	DelMOSum2011_c10157185 Open in IMG/M
Source Dataset Name	Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	668
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine → Marine Microbial Communities From Delaware Coast

Source Dataset Sampling Location
Location Name	Microbial Observatory off the coast of Delaware, USA
Coordinates	Lat. (^o)	38.848917	Long. (^o)	-75.1076	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F041441	Metagenome / Metatranscriptome	160	Y

Sequences

Protein ID	Family	RBS	Sequence
DelMOSum2011_101571852	F041441	N/A	MNEQTRLLLDYQEQAIIALRAEVERLTTENKLLTLKLKRNEYI*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.