Scaffold DelMOSum2011_c10005589

Overview

Basic Information

• Taxon OID: 3300000115
• Scaffold ID: DelMOSum2011_c10005589
• Source Dataset Name: Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 7289
• Total Scaffold Genes: 12
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 10 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine → Marine Microbial Communities From Delaware Coast

Source Dataset Sampling Location

• Location Name: Microbial Observatory off the coast of Delaware, USA
• Coordinates
  • Lat. (^o): 38.848917
  • Long. (^o): -75.1076
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F061045	Metagenome	132	Y

Sequences

Protein ID	Family	RBS	Sequence
DelMOSum2011_1000558910	F061045	GGAG	MVLDPRNNWIQVDLSFDKKEEEVEKSIIALPDDYKPAQKPFKAVSVSADPEKEYQHGDVVVVPTHVVREIQIRDNTFYLIERNHIMAVVSK*