NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold DelMOSum2010_c10143080

Scaffold DelMOSum2010_c10143080


Overview

Basic Information
Taxon OID3300000101 Open in IMG/M
Scaffold IDDelMOSum2010_c10143080 Open in IMG/M
Source Dataset NameMarine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)893
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine → Marine Microbial Communities From Delaware Coast

Source Dataset Sampling Location
Location NameMicrobial Observatory off the coast of Delaware, USA
CoordinatesLat. (o)38.84917Long. (o)-75.1076Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019020Metagenome / Metatranscriptome232Y

Sequences

Protein IDFamilyRBSSequence
DelMOSum2010_101430802F019020N/AYMKGFTEEMQYEILNKEGCEQLDEAYNFLTKGQKTKIVKKLQEFETDIEKYIAEYTPVRKPPKPKTPAQLVKKLPYLSEWKKYKSINPEDIIRASLLFGYNTSTKKLTMFKSYGGLRVNGSKIMDADECIEKTLTDLTLLDRLVSGGNIIAKGFMDEIPRSKEKEGNNRITKNTLLIKVIK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.