Scaffold LCrCPGB2aDRAFT_c023940

Overview

Basic Information

• Taxon OID: 3300000095
• Scaffold ID: LCrCPGB2aDRAFT_c023940
• Source Dataset Name: Soil microbial communities from Colorado Plateau, Green Butte sample - Light Crust, Colorado Plateau, Green Butte 2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 1136
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → unclassified Nitrososphaera → Nitrososphaera sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Sand → Desert → Soil → Soil Microbial Communities From Four Geographically Distinct Crusts In The Colorado Plateau And Sonoran Desert

Source Dataset Sampling Location

• Location Name: USA: Maryland: Natonal Institute of Health
• Coordinates
  • Lat. (^o): 39.0042816
  • Long. (^o): -77.1012173

Associated Families

Family	Category	Number of Sequences	3D Structure?
F093150	Metagenome / Metatranscriptome	106	Y

Sequences

Protein ID	Family	RBS	Sequence
LCrCPGB2aDRAFT_0239402	F093150	AGGA	MNNLYQKVAFASVCTALSFALVANKEAKAAVFTLTASPSFSVGDRNGQDGLGDYISGDVPLPVGIINGEGNRQEYRALYEFNLANLSLAPNTAISSVIFGVKANTISSYGRFSRLDAHGYIGNGQADVSDFEAGEYLDGRYLYSVLLNTTIPGIKPSPFFYFDVLPFISQSIKNNDTSAGFSLRIDDAYLTLNQDARLTIITAXVTESVPEPTTVLTAAVALGWGGWLKRKNSSQQHKTKSQD*