Basic Information | |
---|---|
Taxon OID | 3300000095 Open in IMG/M |
Scaffold ID | LCrCPGB2aDRAFT_c022286 Open in IMG/M |
Source Dataset Name | Soil microbial communities from Colorado Plateau, Green Butte sample - Light Crust, Colorado Plateau, Green Butte 2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1184 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Sand → Desert → Soil → Soil Microbial Communities From Four Geographically Distinct Crusts In The Colorado Plateau And Sonoran Desert |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Maryland: Natonal Institute of Health | |||||||
Coordinates | Lat. (o) | 39.0042816 | Long. (o) | -77.1012173 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F089872 | Metagenome | 108 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
LCrCPGB2aDRAFT_0222862 | F089872 | N/A | VAKKEIEKENEAASAELRVTSEEARSIASLLRYVVSLNTTVGLVSPTHRRLATPTYRAVELAALILEGKSFEEATREAEETWSGCLEEDHHRALELLQTNRYALHSAMTELMNPERFAEYLEISQQQFLELVKSGMLTPAKIPGE* |
⦗Top⦘ |