NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Draft_c011109

Scaffold Draft_c011109


Overview

Basic Information
Taxon OID3300000052 Open in IMG/M
Scaffold IDDraft_c011109 Open in IMG/M
Source Dataset NameCoal bed methane well microbial communities from Alberta, Canada
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMcGill University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)675
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Biotransformation → Microbial Solubilization Of Coal → Unclassified → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location
Location NameAlberta, Canada
CoordinatesLat. (o)52.119Long. (o)-113.78Alt. (m)Depth (m)686
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012849Metagenome / Metatranscriptome276N

Sequences

Protein IDFamilyRBSSequence
Draft_0111092F012849N/AIPFKEFPKPKYPDGFLIHWIIDDMLGTNIFKNGRSTFTNLCIRNRHIIPGNIIIAIQSIMNVPKTIRLNANLXALFKFADSETVLEDVXPLFSAFVKEXQFKELYEYATXEPFXAXVIDATRGKPVFKKNFDKVLNIS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.