Basic Information | |
---|---|
Taxon OID | 3300000051 Open in IMG/M |
Scaffold ID | Botbay15_c058363 Open in IMG/M |
Source Dataset Name | Porifera Cymbastela concentrica microbial communities from Botany Bay, Australia - sample 15 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of New South Wales |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 901 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Porifera Cymbastela Concentrica → Porifera Cymbastela Concentrica Microbial Communities From Botany Bay Near Bare Island, Sydney, Australia |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Botany Bay, Sydney, Australia | |||||||
Coordinates | Lat. (o) | -33.990833 | Long. (o) | 151.23195 | Alt. (m) | Depth (m) | 7 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F031473 | Metagenome / Metatranscriptome | 182 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Botbay15_0583632 | F031473 | N/A | MKEIREFIEESFTPRVDEDMNGVKVIFSSTVGEGTIWFEPAKRGWNRKPLSTNQYIIVDADLTHVLTFLNRYYQLNEENYHDIRRMFIQLGMDMVDRHTKGEE* |
⦗Top⦘ |