Scaffold Botbay15_c042211

Overview

Basic Information

• Taxon OID: 3300000051
• Scaffold ID: Botbay15_c042211
• Source Dataset Name: Porifera Cymbastela concentrica microbial communities from Botany Bay, Australia - sample 15
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of New South Wales
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 634
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Porifera Cymbastela Concentrica → Porifera Cymbastela Concentrica Microbial Communities From Botany Bay Near Bare Island, Sydney, Australia

Source Dataset Sampling Location

• Location Name: Botany Bay, Sydney, Australia
• Coordinates
  • Lat. (^o): -33.990833
  • Long. (^o): 151.23195
  • Depth (m): 7

Associated Families

Family	Category	Number of Sequences	3D Structure?
F092950	Metagenome	107	Y

Sequences

Protein ID	Family	RBS	Sequence
Botbay15_0422111	F092950	N/A	MCPWNGTSQCALGMGLANLPWEWDKKMCPGNGTIQCALEMGLVNVPWKWDYPMCFGNGTSQCALEMGLSNVPWEWD*