Scaffold Botbay15_c008860

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Botbay15_c008860

Scaffold Botbay15_c008860

Overview

Basic Information
Taxon OID	3300000051 Open in IMG/M
Scaffold ID	Botbay15_c008860 Open in IMG/M
Source Dataset Name	Porifera Cymbastela concentrica microbial communities from Botany Bay, Australia - sample 15
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of New South Wales
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	695
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (25.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Porifera Cymbastela Concentrica → Porifera Cymbastela Concentrica Microbial Communities From Botany Bay Near Bare Island, Sydney, Australia

Source Dataset Sampling Location
Location Name	Botany Bay, Sydney, Australia
Coordinates	Lat. (^o)	-33.990833	Long. (^o)	151.23195	Alt. (m)		Depth (m)	7
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F031501	Metagenome / Metatranscriptome	182	N

Sequences

Protein ID	Family	RBS	Sequence
Botbay15_0088601	F031501	GGA	MMTNTTNTIMTTELLDLFDEAKRIIDKQQELIKMQQSIMKTMQQALQGVELNELLLKKQLADLQEELVTITNDYIDVMGGGEKV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.