| Basic Information | |
|---|---|
| Taxon OID | 3300000050 Open in IMG/M |
| Scaffold ID | botbay04_c06542 Open in IMG/M |
| Source Dataset Name | Porifera Cymbastela concentrica microbial communities from Botany Bay, Australia - sample 1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of New South Wales |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 708 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Porifera Cymbastela Concentrica → Porifera Cymbastela Concentrica Microbial Communities From Botany Bay Near Bare Island, Sydney, Australia |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Botany Bay, Sydney, Australia | |||||||
| Coordinates | Lat. (o) | -33.990833 | Long. (o) | 151.23195 | Alt. (m) | Depth (m) | 2 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F092950 | Metagenome | 107 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| botbay04_065423 | F092950 | GGA | MCPGNGTIQYALEMGLANVPWEWDYPMCFGNGTSQCTQGMRLAYVLFELDYPMCPGMGLDNVPWKWD* |
| ⦗Top⦘ |