Scaffold ICChiseqgaiiDRAFT_c2173799

Overview

Basic Information

• Taxon OID: 3300000033
• Scaffold ID: ICChiseqgaiiDRAFT_c2173799
• Source Dataset Name: Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 763
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_13_66_10 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa)

Source Dataset Sampling Location

• Location Name: USA: Maryland: Natonal Institute of Health
• Coordinates
  • Lat. (^o): 39.0042816
  • Long. (^o): -77.1012173
  • Depth (m): .1016

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048818	Metagenome / Metatranscriptome	147	Y

Sequences

Protein ID	Family	RBS	Sequence
ICChiseqgaiiDRAFT_21737992	F048818	N/A	ATALLLMAVGAVSAASTASSLPPXWHVHDGQGATLGSQHKGIGFFPAILGVSAATYLEDPARCPNATDKAFLDSADTSNADVLRAGVCETDTQVIHLRTVPVGTAGPGGWASITTASEPGFVTYYLVVAR*