Basic Information | |
---|---|
Taxon OID | 3300000032 Open in IMG/M |
Scaffold ID | Draft_c0044221 Open in IMG/M |
Source Dataset Name | Oil sands microbial community from Northern Alberta which degrade Naphthaline |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | McGill University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1614 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Syncrude tailings pond, Wood Buffalo, Alberta, Canada | |||||||
Coordinates | Lat. (o) | 57.02 | Long. (o) | -111.55 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F011593 | Metagenome / Metatranscriptome | 289 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Draft_00442212 | F011593 | AGCAGG | VTDNNLSAPEWCLGCPDPIYDDRRGEWDWYCRQHSPTGIGCSNVAVLRERCYRVRDYFSNREAST* |
⦗Top⦘ |