NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Draft_c0019313

Scaffold Draft_c0019313


Overview

Basic Information
Taxon OID3300000032 Open in IMG/M
Scaffold IDDraft_c0019313 Open in IMG/M
Source Dataset NameOil sands microbial community from Northern Alberta which degrade Naphthaline
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMcGill University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)25339
Total Scaffold Genes21 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)17 (80.95%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location
Location NameSyncrude tailings pond, Wood Buffalo, Alberta, Canada
CoordinatesLat. (o)57.02Long. (o)-111.55Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F026911Metagenome / Metatranscriptome196Y

Sequences

Protein IDFamilyRBSSequence
Draft_001931315F026911AGGAGMSNYNFCLNCEQIKTTMVSGLNGTMVRELSCPARFNPMEAKWILKDGINPHECPRNENFMQIQNQNGDRRLR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.