NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold CowRDRAFT01_c0132121

Scaffold CowRDRAFT01_c0132121


Overview

Basic Information
Taxon OID2236876025 Open in IMG/M
Scaffold IDCowRDRAFT01_c0132121 Open in IMG/M
Source Dataset NameSwitchgrass-associated rumen community WFO
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)747
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Stomach → Unclassified → Switchgrass-Associated Bovine Rumen → Switchgrass-Associated Bovine Rumen Microbial Communities From Urbana, Illinois, Usa

Source Dataset Sampling Location
Location NameUrbana
CoordinatesLat. (o)40.1Long. (o)-88.26Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F076635Metagenome / Metatranscriptome118Y

Sequences

Protein IDFamilyRBSSequence
CowRDRAFT01_01321212F076635AGGAGGMIKRGSKIRVVKMDTAGGMDWQAKRLEGKVFTVRFIDSTGQIHLEETGLALIPGVDEYEIVK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.