Basic Information | |
---|---|
Taxon OID | 2236876025 Open in IMG/M |
Scaffold ID | CowRDRAFT01_c0028316 Open in IMG/M |
Source Dataset Name | Switchgrass-associated rumen community WFO |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1977 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Mammals → Digestive System → Stomach → Unclassified → Switchgrass-Associated Bovine Rumen → Switchgrass-Associated Bovine Rumen Microbial Communities From Urbana, Illinois, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Urbana | |||||||
Coordinates | Lat. (o) | 40.1 | Long. (o) | -88.26 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F076635 | Metagenome / Metatranscriptome | 118 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
CowRDRAFT01_00283162 | F076635 | AGGAGG | MIKRGSKVRVVKMDTAGGMDWQAKRLEGKVFTVRFIDSAGMIHLEETGIALIPGVDQFEVVK |
⦗Top⦘ |