| Basic Information | |
|---|---|
| Taxon OID | 2236876023 Open in IMG/M |
| Scaffold ID | PC6_p0572622 Open in IMG/M |
| Source Dataset Name | Saline water concentrator pond microbial communities from Bras del Port saltern, Spain - PC6 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | GATC-Biotech AG, Konstanz, Germany |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 970 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water Concentrator Pond → Saline Water Concentrator Pond Microbial Communities From Bras Del Port Saltern, Santa Pola, Spain |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Punta Cormorant, Spain | |||||||
| Coordinates | Lat. (o) | 38.11 | Long. (o) | -0.36 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F034000 | Metagenome | 176 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| PC6_05726223 | F034000 | N/A | QQLFNLAAQLVELTTEEEREDYPFFDHLQDLIDDLEMEEAE |
| ⦗Top⦘ |