Scaffold PC6_p0543203

Overview

Basic Information

• Taxon OID: 2236876023
• Scaffold ID: PC6_p0543203
• Source Dataset Name: Saline water concentrator pond microbial communities from Bras del Port saltern, Spain - PC6
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: GATC-Biotech AG, Konstanz, Germany
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 933
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water Concentrator Pond → Saline Water Concentrator Pond Microbial Communities From Bras Del Port Saltern, Santa Pola, Spain

Source Dataset Sampling Location

• Location Name: Punta Cormorant, Spain
• Coordinates
  • Lat. (^o): 38.11
  • Long. (^o): -0.36

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030930	Metagenome / Metatranscriptome	184	N

Sequences

Protein ID	Family	RBS	Sequence
PC6_05432033	F030930	N/A	LTVVHEVPSEDLVANRYHVGFSLDDPRFKGFDIDRWAEPEMRSILMRSLADEWAEGALVIIGCEEISGSAQWGRHD