Scaffold none_p0446917

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold none_p0446917

Scaffold none_p0446917

Overview

Basic Information
Taxon OID	2236876010 Open in IMG/M
Scaffold ID	none_p0446917 Open in IMG/M
Source Dataset Name	Marine microbial communities from Columbia River, CM, sample from Newport Hydroline, GS310-0p1-Hyp-75m
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of South Carolina
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	522
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine Estuarine → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin

Source Dataset Sampling Location
Location Name	Newport Hydroline 10 km (NH10)
Coordinates	Lat. (^o)	44.651	Long. (^o)	-124.295	Alt. (m)		Depth (m)	75
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025151	Metagenome / Metatranscriptome	203	Y

Sequences

Protein ID	Family	RBS	Sequence
none_04469172	F025151	GGAG	VGELISRNPKRTQERLSSLRSIVKPKKPKRRFPSDFNNEEYLEWTSISSDNVDYEITPLVKGAGRLGELVDWCDDNCSKLYIIGKSQ

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.