Basic Information | |
---|---|
Taxon OID | 2236876010 Open in IMG/M |
Scaffold ID | none_p0114826 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Columbia River, CM, sample from Newport Hydroline, GS310-0p1-Hyp-75m |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of South Carolina |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 507 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine Estuarine → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Newport Hydroline 10 km (NH10) | |||||||
Coordinates | Lat. (o) | 44.651 | Long. (o) | -124.295 | Alt. (m) | Depth (m) | 75 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F025151 | Metagenome / Metatranscriptome | 203 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
none_01148261 | F025151 | GGAG | VGELIRRNPLRTQERLMRLRRIVGPEKNPKRRFASDFDNDEYLKWTAISSDKIDYELKPLVRGAGRLGELVDWCDDNCNGIYVIGKGDKIYFEDENDAAM |
⦗Top⦘ |