Scaffold none_p295086

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold none_p295086

Scaffold none_p295086

Overview

Basic Information
Taxon OID	2236876008 Open in IMG/M
Scaffold ID	none_p295086 Open in IMG/M
Source Dataset Name	Marine microbial communities from Columbia River, CM, sample from Cape Meares, GS311-3LG-Deep1200
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of South Carolina
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	508
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine Estuarine → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin

Source Dataset Sampling Location
Location Name	Cape Meares
Coordinates	Lat. (^o)	45.483	Long. (^o)	-124.918	Alt. (m)		Depth (m)	1200
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024807	Metagenome	204	N

Sequences

Protein ID	Family	RBS	Sequence
none_2950862	F024807	N/A	YRDKDQQLTLALHDNPVTLTRDEVDGLIFHLDSFLIDMDKERKPKPSAEGADTHAEAHGEMLMAQYDDEPNPYHGNFSED*KAKYGAGGAIPLSLLYQYVK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.